PTM Viewer PTM Viewer

AT4G32060.1

Arabidopsis thaliana [ath]

calcium-binding EF hand family protein

No PTMs currently found

PLAZA: AT4G32060
Gene Family: HOM05D002817
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 498

MPALSHYRSVSSLPSVDRSFLLIQRLRIHGSSSSFPESSPSASILSGADPLKCTVSGGSLAKWITGISAGSALGFLYWSSGSSDSISGLFGGSNLLSFADSSTPSVCGVKVGDLKPRSFIPKLSLPGYSSGFIFGDAYRRKIFFNYEKRLRLQSPPEKVFEYFASVRTDKGEILMKPADLMRAIVPVFPPSESHLVREGYLTGERNPGELRCSPSEFFMLFDVDNDGLISFKEYIFFVTLLSIPESSFAVAFKMFDTDNNGEIDKEEFKTVMSLMRSQHRQGVGHRDGLRTGLHMTGSVEDGGLVEYFFGKDGSQKLKHDKFTKFMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADASHLSKLLDRVESLSEHPHLRDMRISLKEFKQFDELRSKLGPFSLALFAYGKANGLLTMKDFKRAASQVCGITLSDNVIEIAFHVFDSNQDGNLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWKGSKNCSSS

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002048 213 278
417 472
Molecule Processing
Show Type From To
Transit Peptide 1 29
Sites
Show Type Position
Active Site 222
Active Site 224
Active Site 226
Active Site 233
Active Site 256
Active Site 258
Active Site 260
Active Site 262
Active Site 267
Active Site 450
Active Site 452
Active Site 454
Active Site 456
Active Site 461

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here